(data stored in ACNUC7421 zone)

EMBL: CP000462.RPSM

CP000462.RPSM        Location/Qualifiers
FT   CDS             346228..346584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="AHA_0330"
FT                   /product="ribosomal protein S13p/S18e"
FT                   /note="identified by match to protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38153"
FT                   /db_xref="GOA:A0KF42"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF42"
FT                   /protein_id="ABK38153.1"
FT                   /translation="MARIAGINIPDHKHAVIALTAIYGVGRTRSKAICAAAGIAENVKI
FT                   KDLDEAQIESLREQVGKFTVEGDLRRQISMNIKRLMDLGCYRGLRHRRSLPVRGQRTKT
FT                   NARTRKGPRKAIKK"
     MARIAGINIP DHKHAVIALT AIYGVGRTRS KAICAAAGIA ENVKIKDLDE AQIESLREQV        60
     GKFTVEGDLR RQISMNIKRL MDLGCYRGLR HRRSLPVRGQ RTKTNARTRK GPRKAIKK         118
//

If you have problems or comments...

PBIL Back to PBIL home page