(data stored in ACNUC7421 zone)

EMBL: CP000462.RPSS

CP000462.RPSS        Location/Qualifiers
FT   CDS             338215..338493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="AHA_0313"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39570"
FT                   /db_xref="GOA:A0KF25"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF25"
FT                   /protein_id="ABK39570.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPVKTWSRRSMIIPNMI
FT                   GLTIAVHNGRQHVPVFVTEEMIGHKLGEFAPTRTYRGHAADKKAKKR"
     MPRSLKKGPF IDLHLLKKVE KAVESGDKKP VKTWSRRSMI IPNMIGLTIA VHNGRQHVPV        60
     FVTEEMIGHK LGEFAPTRTY RGHAADKKAK KR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page