(data stored in ACNUC7421 zone)

EMBL: CP000462.SUN

CP000462.SUN         Location/Qualifiers
FT   CDS             complement(280913..282205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="AHA_0256"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM PF01189; match to protein
FT                   family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37178"
FT                   /db_xref="GOA:A0KEW8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW8"
FT                   /protein_id="ABK37178.1"
FT                   /translation="MKTRAQAALVIQQVLDQGQSLSAVLPAAQEKVAPRDRALLQELCY
FT                   GTLRWLPRLDAAVGEMMDKPLKNKSRIFHYLILVGLYQLIYTRIPAHAAVAETVNAVKL
FT                   LKGTSLRGLINGVLRNFQRSAEVILLRIDRVPSIRLGHPEWLTKRLRQAYPDEWEFIME
FT                   ANNQRPPMWIRNNSQRQSREQMLVRMAEAGINAMAGEEGEDCILLERPCDVTKLPGFEA
FT                   GDCSVQDGAAQQAAALLDPQPGEWVLDACAAPGGKTAHLLERQPALAGVVAVDADDNRL
FT                   KRVQENLDRIGLTAKVIHGDASTPDLWWPEGQFDRILLDAPCSATGVIRRHPDIKWLRR
FT                   DQDIRELAELQHRILGALWSKLKSGGTLLYATCSVLPEENRDQIRAFLAATPDATLVPL
FT                   HAQDTPECPGRQFLPGEAEMDGFYYAKLIKR"
     MKTRAQAALV IQQVLDQGQS LSAVLPAAQE KVAPRDRALL QELCYGTLRW LPRLDAAVGE        60
     MMDKPLKNKS RIFHYLILVG LYQLIYTRIP AHAAVAETVN AVKLLKGTSL RGLINGVLRN       120
     FQRSAEVILL RIDRVPSIRL GHPEWLTKRL RQAYPDEWEF IMEANNQRPP MWIRNNSQRQ       180
     SREQMLVRMA EAGINAMAGE EGEDCILLER PCDVTKLPGF EAGDCSVQDG AAQQAAALLD       240
     PQPGEWVLDA CAAPGGKTAH LLERQPALAG VVAVDADDNR LKRVQENLDR IGLTAKVIHG       300
     DASTPDLWWP EGQFDRILLD APCSATGVIR RHPDIKWLRR DQDIRELAEL QHRILGALWS       360
     KLKSGGTLLY ATCSVLPEEN RDQIRAFLAA TPDATLVPLH AQDTPECPGR QFLPGEAEMD       420
     GFYYAKLIKR                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page