(data stored in ACNUC7421 zone)

EMBL: CP000462.TATC

CP000462.TATC        Location/Qualifiers
FT   CDS             96498..97253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="AHA_0089"
FT                   /product="twin arginine-targeting protein translocase TatC"
FT                   /note="identified by similarity to SP:P69423; match to
FT                   protein family HMM PF00902; match to protein family HMM
FT                   TIGR00945"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38683"
FT                   /db_xref="GOA:A0KEG1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG1"
FT                   /protein_id="ABK38683.1"
FT                   /translation="MSQAEQPLISHLVELRTRLLRSISAILLVFIALIYFSNNIYDFVA
FT                   QPLLSQLPEGTSMIATDVATPFLTPIKLTLVVSFFVAIPYLLYQAWAFIAPGLYQHERR
FT                   LIMPLVASSAVLFYAGMAFAYYVVFPLVFGFFTSTAPAGVTVATDIASYLDFVLTLFFA
FT                   FGVAFEIPVATILLCWTGVTSPKSLREKRPYVIVGVFVVGMLLTPPDVFSQTLLAIPMW
FT                   GLWEIGLFFARFYVKEESEEKQEQTEEGS"
     MSQAEQPLIS HLVELRTRLL RSISAILLVF IALIYFSNNI YDFVAQPLLS QLPEGTSMIA        60
     TDVATPFLTP IKLTLVVSFF VAIPYLLYQA WAFIAPGLYQ HERRLIMPLV ASSAVLFYAG       120
     MAFAYYVVFP LVFGFFTSTA PAGVTVATDI ASYLDFVLTL FFAFGVAFEI PVATILLCWT       180
     GVTSPKSLRE KRPYVIVGVF VVGMLLTPPD VFSQTLLAIP MWGLWEIGLF FARFYVKEES       240
     EEKQEQTEEG S                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page