(data stored in ACNUC7421 zone)

EMBL: CP000462.THIF

CP000462.THIF        Location/Qualifiers
FT   CDS             472161..472919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="AHA_0441"
FT                   /product="thiazole biosynthesis adenylyltransferase ThiF"
FT                   /note="identified by similarity to SP:P30138; match to
FT                   protein family HMM PF00899; match to protein family HMM
FT                   PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38994"
FT                   /db_xref="GOA:A0KFE8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE8"
FT                   /protein_id="ABK38994.1"
FT                   /translation="MLADAEYLRYGRQLMLAEVGEEGQARLKDKSVLIVGLGGLGSPLA
FT                   LYLAGAGVGTLWLADGDTVDSSNLPRQILFDSEAVNHSKAELARERLAAHNPLVELIAI
FT                   NQRLDAASLPEFVAEVDLVIDCCDNLATRQAINAACVAQGKPWVCAAAVGWQGQLMVRT
FT                   SSEHACYACLYPLDTEIKESCETSGVTGPLVGVMGSLQALEALKLLFGMQSPVAGTLRR
FT                   FDALAHQWQTLTLAPDPDCPVCGPHKEITP"
     MLADAEYLRY GRQLMLAEVG EEGQARLKDK SVLIVGLGGL GSPLALYLAG AGVGTLWLAD        60
     GDTVDSSNLP RQILFDSEAV NHSKAELARE RLAAHNPLVE LIAINQRLDA ASLPEFVAEV       120
     DLVIDCCDNL ATRQAINAAC VAQGKPWVCA AAVGWQGQLM VRTSSEHACY ACLYPLDTEI       180
     KESCETSGVT GPLVGVMGSL QALEALKLLF GMQSPVAGTL RRFDALAHQW QTLTLAPDPD       240
     CPVCGPHKEI TP                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page