(data stored in ACNUC7421 zone)

EMBL: CP000462.THIH

CP000462.THIH        Location/Qualifiers
FT   CDS             473927..475198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="AHA_0444"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968; match to protein
FT                   family HMM TIGR02351"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39165"
FT                   /db_xref="GOA:A0KFF1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF1"
FT                   /protein_id="ABK39165.1"
FT                   /translation="MSSFSVSPEADVFSPPLPLGEGLGVRAEADSVLEGGEPCTPPPPK
FT                   GEAGRGLDFANRWQELEWDDIGMQIRAKTAADVARALSAPRRTLADFMALISPAAEAYL
FT                   PQMAAEAERLTRQRFGNTIGFYVPLYLSNLCANDCTYCGFSMSNRLKRKTLNAEEIERE
FT                   CLAIKARGFDSVLLVTGEHEHKVGLAYFREVMPIIRRHFSTVGMEVQPLSQDEYAELKS
FT                   LGLDSVMVYQETYHAPTYARHHLRGNKREIAWRLATPDRLGRAGIDKIGLGALIGLSSD
FT                   WRADSYFVAEHLAWLERHHWQSRYSLSFPRLRPCTGGLEPAVVMSDRQLAQLICAWRLF
FT                   SPTLDLSLSTRESATFRNGAVRLGITQMSAESRTQPGGYAEGDAEELEQFAIHDDRPVG
FT                   EVAAAVRQAGLQPVFKDWEPFLGR"
     MSSFSVSPEA DVFSPPLPLG EGLGVRAEAD SVLEGGEPCT PPPPKGEAGR GLDFANRWQE        60
     LEWDDIGMQI RAKTAADVAR ALSAPRRTLA DFMALISPAA EAYLPQMAAE AERLTRQRFG       120
     NTIGFYVPLY LSNLCANDCT YCGFSMSNRL KRKTLNAEEI ERECLAIKAR GFDSVLLVTG       180
     EHEHKVGLAY FREVMPIIRR HFSTVGMEVQ PLSQDEYAEL KSLGLDSVMV YQETYHAPTY       240
     ARHHLRGNKR EIAWRLATPD RLGRAGIDKI GLGALIGLSS DWRADSYFVA EHLAWLERHH       300
     WQSRYSLSFP RLRPCTGGLE PAVVMSDRQL AQLICAWRLF SPTLDLSLST RESATFRNGA       360
     VRLGITQMSA ESRTQPGGYA EGDAEELEQF AIHDDRPVGE VAAAVRQAGL QPVFKDWEPF       420
     LGR                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page