(data stored in ACNUC7421 zone)

EMBL: CP000462.TLDD

CP000462.TLDD        Location/Qualifiers
FT   CDS             432389..433828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="AHA_0408"
FT                   /product="protein TldD"
FT                   /note="identified by similarity to SP:P46473; match to
FT                   protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36234"
FT                   /db_xref="GOA:A0KFB5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB5"
FT                   /protein_id="ABK36234.1"
FT                   /translation="MSQVSASLLAPHDLDEGRLQQLLGSLMSHQVEFGDLYFQRSWHES
FT                   WMLEDGIVKDGSYNIDQGVGVRAVSGEKTGFAYSDELSLLALQQSVTAARGIAAAGAQG
FT                   KVKAWARTEANLLYPALDPLQTLDKQQKIALLEQMDKFARSLDPAINQVMASISGVYEE
FT                   VLVAATDGTLAADVRPLVRLSVTVIAEKGDRRERGSAGGGGRFGYDYFLELDGLESRAF
FT                   GYVREAVRQALVNLDAIDAPAGTMPVVLGAGWPGVLLHEAVGHGLEGDFNRKGSSAFAG
FT                   RIGEQVASKHCTIVDDGTLPGRRGSVSIDDEGTPGGYNVLIENGILKGYLQDKQNARLM
FT                   GVPLTGNGRRESYAALPMPRMTNTYMLAGQYDPAEIIASVKKGIYAPNFGGGQVDITSG
FT                   KFVFSASEAYLIEDGKITAPIKGATLIGNGPEAMSQVSMVGKDLALDRGVGVCGKEGQS
FT                   VPVGVGQPTLKLDQLTVGGTQ"
     MSQVSASLLA PHDLDEGRLQ QLLGSLMSHQ VEFGDLYFQR SWHESWMLED GIVKDGSYNI        60
     DQGVGVRAVS GEKTGFAYSD ELSLLALQQS VTAARGIAAA GAQGKVKAWA RTEANLLYPA       120
     LDPLQTLDKQ QKIALLEQMD KFARSLDPAI NQVMASISGV YEEVLVAATD GTLAADVRPL       180
     VRLSVTVIAE KGDRRERGSA GGGGRFGYDY FLELDGLESR AFGYVREAVR QALVNLDAID       240
     APAGTMPVVL GAGWPGVLLH EAVGHGLEGD FNRKGSSAFA GRIGEQVASK HCTIVDDGTL       300
     PGRRGSVSID DEGTPGGYNV LIENGILKGY LQDKQNARLM GVPLTGNGRR ESYAALPMPR       360
     MTNTYMLAGQ YDPAEIIASV KKGIYAPNFG GGQVDITSGK FVFSASEAYL IEDGKITAPI       420
     KGATLIGNGP EAMSQVSMVG KDLALDRGVG VCGKEGQSVP VGVGQPTLKL DQLTVGGTQ        479
//

If you have problems or comments...

PBIL Back to PBIL home page