(data stored in ACNUC7421 zone)

EMBL: CP000462.TRX

CP000462.TRX         Location/Qualifiers
FT   CDS             109476..109802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="AHA_0098"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36091"
FT                   /db_xref="GOA:A0KEH0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH0"
FT                   /protein_id="ABK36091.1"
FT                   /translation="MSDKIVQLSDASFEADVIKADGAVLVDFWAEWCGPCKMIAPILNE
FT                   VAQEYAGRVTVAKLNIDHNADTPPKYGIRGIPTLLLFKNGEVAATKVGALSKTQLKEFL
FT                   DGNL"
     MSDKIVQLSD ASFEADVIKA DGAVLVDFWA EWCGPCKMIA PILNEVAQEY AGRVTVAKLN        60
     IDHNADTPPK YGIRGIPTLL LFKNGEVAAT KVGALSKTQL KEFLDGNL                    108
//

If you have problems or comments...

PBIL Back to PBIL home page