(data stored in ACNUC7421 zone)

EMBL: CP000462.TYRS-1

CP000462.TYRS-1      Location/Qualifiers
FT   CDS             615563..616831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS-1"
FT                   /locus_tag="AHA_0581"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39461"
FT                   /db_xref="GOA:A0KFT8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFT8"
FT                   /protein_id="ABK39461.1"
FT                   /translation="MINPHLLDELTRRGLVAQNSDPVALADHLATPRTVYCGFDPTAGS
FT                   LHIGHLVPLLMLRRFQLAGHTPVALVGGATGLIGDPSFKATERNLNSSETVQGWVASLS
FT                   AQIKALLPASEGLAAPLLVNNADWMGQMSALDFLRDIGKHFSVNAMLVRESVRQRLARP
FT                   DQGISFTEFSYALLQSQDYAVLNQRLGCTLQIGGNDQWGNITSGMDLTRRLHQAQVYGM
FT                   TLPLITKADGTKFGKTEGGAIWLDPALTSPYAFYQFWLGTADEDVYRFLRYYSFMPLTE
FT                   IEALEAEDAKRQGRKLAQQVLADELTELVHGKGALAAAQRISELLFSGEVARLGESDLA
FT                   QLAQDGMPGWRIEGETDLVTLLVESGLANSKRIARELLAAGAISLNGEIRREEPLRAAD
FT                   RLFGRHLLLRRGKKQYRLVTWQG"
     MINPHLLDEL TRRGLVAQNS DPVALADHLA TPRTVYCGFD PTAGSLHIGH LVPLLMLRRF        60
     QLAGHTPVAL VGGATGLIGD PSFKATERNL NSSETVQGWV ASLSAQIKAL LPASEGLAAP       120
     LLVNNADWMG QMSALDFLRD IGKHFSVNAM LVRESVRQRL ARPDQGISFT EFSYALLQSQ       180
     DYAVLNQRLG CTLQIGGNDQ WGNITSGMDL TRRLHQAQVY GMTLPLITKA DGTKFGKTEG       240
     GAIWLDPALT SPYAFYQFWL GTADEDVYRF LRYYSFMPLT EIEALEAEDA KRQGRKLAQQ       300
     VLADELTELV HGKGALAAAQ RISELLFSGE VARLGESDLA QLAQDGMPGW RIEGETDLVT       360
     LLVESGLANS KRIARELLAA GAISLNGEIR REEPLRAADR LFGRHLLLRR GKKQYRLVTW       420
     QG                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page