(data stored in ACNUC7421 zone)

EMBL: CP000462.UBIB

CP000462.UBIB        Location/Qualifiers
FT   CDS             94125..95765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="AHA_0086"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF03109;
FT                   match to protein family HMM TIGR01982"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38880"
FT                   /db_xref="GOA:A0KEF8"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEF8"
FT                   /protein_id="ABK38880.1"
FT                   /translation="MTPKEFKRLYRIISILLEQGIDELVPARYQPWPGRLARRSLFWLK
FT                   NKRQGLNRGARIRLAFEALGPIFIKFGQMLSTRRDLLPPDIAEELALLQDRVPPFCGQA
FT                   ARRQIEASLGCTIETLFDDFDETPLASASIAQVHTARLKENGREIVIKVIRPDIEPVIE
FT                   ADLRLMQALARLVARFVPQSGRLRPIEVVEEYRKTILDELNLMREAANAIQLRRNFTGS
FT                   EALYVPEVFTEHCREQVLVMERIYGIPVSDIAALEANGTNMKLLAERGVEVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPENPLWIGIDCGIVGTLNREDKRYLAENFLAFFNRDYRRVA
FT                   ELHVESGWVPPDTKVDEFEFAIRTVLEPIFEKPLSEISFGHVLLNLFNTARRFNMQVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWQTAKPYLENWMYQQVGPKAVWNAIKEKAPFWAE
FT                   KLPELPELVYETLRQTRHQQRHFDQMFADFRRHSRRQGQARYLLGVGASLLLAGVFLLT
FT                   QKQHIEWGQISLAGAGLCWLLGWLRTRSH"
     MTPKEFKRLY RIISILLEQG IDELVPARYQ PWPGRLARRS LFWLKNKRQG LNRGARIRLA        60
     FEALGPIFIK FGQMLSTRRD LLPPDIAEEL ALLQDRVPPF CGQAARRQIE ASLGCTIETL       120
     FDDFDETPLA SASIAQVHTA RLKENGREIV IKVIRPDIEP VIEADLRLMQ ALARLVARFV       180
     PQSGRLRPIE VVEEYRKTIL DELNLMREAA NAIQLRRNFT GSEALYVPEV FTEHCREQVL       240
     VMERIYGIPV SDIAALEANG TNMKLLAERG VEVFFTQVFR DSFFHADMHP GNIFVSYEHP       300
     ENPLWIGIDC GIVGTLNRED KRYLAENFLA FFNRDYRRVA ELHVESGWVP PDTKVDEFEF       360
     AIRTVLEPIF EKPLSEISFG HVLLNLFNTA RRFNMQVQPQ LVLLQKTLLY VEGLGRQLYP       420
     QLDLWQTAKP YLENWMYQQV GPKAVWNAIK EKAPFWAEKL PELPELVYET LRQTRHQQRH       480
     FDQMFADFRR HSRRQGQARY LLGVGASLLL AGVFLLTQKQ HIEWGQISLA GAGLCWLLGW       540
     LRTRSH                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page