(data stored in ACNUC7421 zone)

EMBL: CP000462.WAAA

CP000462.WAAA        Location/Qualifiers
FT   CDS             188870..190135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaA"
FT                   /locus_tag="AHA_0170"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF00534;
FT                   match to protein family HMM PF04413"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38792"
FT                   /db_xref="GOA:A0KEN8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEN8"
FT                   /protein_id="ABK38792.1"
FT                   /translation="MGYRLLYNLLIHLGLPLALLALYKPKKGKPGFGKRWAEHLGRTPA
FT                   TGQEAPLWIHAVSVGETLAISPFIRALKAERPDLPILLTTTTRTGAEQAARLGDLVEHR
FT                   YAPLDYPWAVAAFLNAVKPRALWVMETELWPNWLAACEERHLPVTIINARLSERSCRRY
FT                   GRFQGAFDALSQPLTHLLCQHQDDADRFHRLGLGRERLAVTGSIKFDIQLDEQVQARGR
FT                   ALRQLLGAERPVWIAASTHQGEDEQVLAAFDRVLAAQPSALLILVPRHPERFERVAALC
FT                   APYGCVRRTAGGAVGEHDKVYLGDTMGELPLMLAAADVAFVGGSLVKVGGHNLLEPAAL
FT                   GKPCLSGPAYFNFSDITRQLVAQGGAAVVADAAALGEQVSALLADESRRREMGEQARAV
FT                   VLRNQGALARTLSHCLASLEND"
     MGYRLLYNLL IHLGLPLALL ALYKPKKGKP GFGKRWAEHL GRTPATGQEA PLWIHAVSVG        60
     ETLAISPFIR ALKAERPDLP ILLTTTTRTG AEQAARLGDL VEHRYAPLDY PWAVAAFLNA       120
     VKPRALWVME TELWPNWLAA CEERHLPVTI INARLSERSC RRYGRFQGAF DALSQPLTHL       180
     LCQHQDDADR FHRLGLGRER LAVTGSIKFD IQLDEQVQAR GRALRQLLGA ERPVWIAAST       240
     HQGEDEQVLA AFDRVLAAQP SALLILVPRH PERFERVAAL CAPYGCVRRT AGGAVGEHDK       300
     VYLGDTMGEL PLMLAAADVA FVGGSLVKVG GHNLLEPAAL GKPCLSGPAY FNFSDITRQL       360
     VAQGGAAVVA DAAALGEQVS ALLADESRRR EMGEQARAVV LRNQGALART LSHCLASLEN       420
     D                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page