(data stored in ACNUC7421 zone)

EMBL: CP000478.PE1

CP000478.PE1         Location/Qualifiers
FT   CDS             346..1698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   KEGG: pca:Pcar_0001 chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15705"
FT                   /db_xref="GOA:A0LE53"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LE53"
FT                   /protein_id="ABK15705.1"
FT                   /translation="MEQEWLQVRKKLQRSLSKGQYDLWVSTLEFLGIEDGNLILGCQNR
FT                   FHIEWLREKLEAKLLPIASQHFRGVRKLEYRVAQGCAAGAPEIEGAGPRQIAFSDVVKC
FT                   VGPAFNPRFTFDHFVVGGCNQFAYAAAMGMANNQQLYNQSVYLLSDTGLGKSHLTHAVG
FT                   NYLRNRKPELRVQYVTTEQFANEMIFSLKNGNMEAFKNKFRTGCDVLLLEKIEFLSGKE
FT                   KIQKELVYTLDELMDRGKTVLCTGNAYPKDIPKLNSELQSRLGGGLLAPIDKPDFKTRI
FT                   EIIKRKSHTENIRVPMEVVEYLADRITGDVRQLESCLVGLMAKSNILRTPITLDLAREV
FT                   SQTMLDQLPKISVEQIQKIICANFRITLEELRSTSRRKQVALARKIGIYLSREYTTESL
FT                   QSIGKSFQRSHSSVLYAVNEVQKGMGEANGRLKREVEYLSRRLETSCLSES"
     MEQEWLQVRK KLQRSLSKGQ YDLWVSTLEF LGIEDGNLIL GCQNRFHIEW LREKLEAKLL        60
     PIASQHFRGV RKLEYRVAQG CAAGAPEIEG AGPRQIAFSD VVKCVGPAFN PRFTFDHFVV       120
     GGCNQFAYAA AMGMANNQQL YNQSVYLLSD TGLGKSHLTH AVGNYLRNRK PELRVQYVTT       180
     EQFANEMIFS LKNGNMEAFK NKFRTGCDVL LLEKIEFLSG KEKIQKELVY TLDELMDRGK       240
     TVLCTGNAYP KDIPKLNSEL QSRLGGGLLA PIDKPDFKTR IEIIKRKSHT ENIRVPMEVV       300
     EYLADRITGD VRQLESCLVG LMAKSNILRT PITLDLAREV SQTMLDQLPK ISVEQIQKII       360
     CANFRITLEE LRSTSRRKQV ALARKIGIYL SREYTTESLQ SIGKSFQRSH SSVLYAVNEV       420
     QKGMGEANGR LKREVEYLSR RLETSCLSES                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page