(data stored in ACNUC7421 zone)

EMBL: CP000478.PE101

CP000478.PE101       Location/Qualifiers
FT   CDS             complement(124691..125140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0102"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: mfa:Mfla_1343
FT                   general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15805"
FT                   /db_xref="GOA:A0LEF3"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF3"
FT                   /protein_id="ABK15805.1"
FT                   /translation="MHGSQDTCHGGKNPRRSKAGFTLIELLIVMIILGLLAALVGPRLI
FT                   HKLGGSRQQAAKTQISMIGTALDAYRLDIGRYPTTEEGLGALRKNPGYKKWDGPYLSKE
FT                   LPDDPWGQAYLYRSPGEHGEYDLYSLGADAQEGGEAENADVVNWN"
     MHGSQDTCHG GKNPRRSKAG FTLIELLIVM IILGLLAALV GPRLIHKLGG SRQQAAKTQI        60
     SMIGTALDAY RLDIGRYPTT EEGLGALRKN PGYKKWDGPY LSKELPDDPW GQAYLYRSPG       120
     EHGEYDLYSL GADAQEGGEA ENADVVNWN                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page