(data stored in ACNUC7421 zone)

EMBL: CP000478.PE106

CP000478.PE106       Location/Qualifiers
FT   CDS             130130..131119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0107"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   electron transfer flavoprotein, alpha subunit; KEGG:
FT                   sat:SYN_02637 electron transfer flavoprotein alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15810"
FT                   /db_xref="GOA:A0LEF8"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF8"
FT                   /protein_id="ABK15810.1"
FT                   /translation="MGKCVCMIAEFRGGNFRRVSFEVASEGKRIADALGIGLRGVAVGS
FT                   GVAGKAAELGQYGVERVLVRDDPALEHYLAEIYVPVVAEMIKKCDPAVVILPASVDGRD
FT                   LGARLGARLDITLVQDVTQVVCEGGKVKARWPIFGGKCFAWSEWADGTLPIMSCRPNVM
FT                   DCLPPDTSKRAEVELADIPIPESRSRVKAVDMDSSGKVELSEADIIVSGGRGMKEASNF
FT                   ALVEELAKAMGAAVGASRAAVDAGWRPHSDQVGQTGKVVTPALYVAVGISGAIQHLAGM
FT                   GYSRYIVAINKDPEAPIFSRADYGIVEDLFKFVPAFTEEVKRLKSTCS"
     MGKCVCMIAE FRGGNFRRVS FEVASEGKRI ADALGIGLRG VAVGSGVAGK AAELGQYGVE        60
     RVLVRDDPAL EHYLAEIYVP VVAEMIKKCD PAVVILPASV DGRDLGARLG ARLDITLVQD       120
     VTQVVCEGGK VKARWPIFGG KCFAWSEWAD GTLPIMSCRP NVMDCLPPDT SKRAEVELAD       180
     IPIPESRSRV KAVDMDSSGK VELSEADIIV SGGRGMKEAS NFALVEELAK AMGAAVGASR       240
     AAVDAGWRPH SDQVGQTGKV VTPALYVAVG ISGAIQHLAG MGYSRYIVAI NKDPEAPIFS       300
     RADYGIVEDL FKFVPAFTEE VKRLKSTCS                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page