(data stored in ACNUC7421 zone)

EMBL: CP000478.PE109

CP000478.PE109       Location/Qualifiers
FT   CDS             133900..135246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0110"
FT                   /product="Uncharacterised conserved protein UCP033563"
FT                   /note="PFAM: Uncharacterised conserved protein UCP033563;
FT                   KEGG: pca:Pcar_2153 conserved hypothetical protein-putative
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15813"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG1"
FT                   /protein_id="ABK15813.1"
FT                   /translation="MAEIAPFRGLRYSPKAAPDLAKVVIPPYDVISPAEQELFLHTSPY
FT                   NMVHLELGRSDRSDTPENNSHTRAGRTFEDWVRNGVLVREALPAVYYYELDYALSPGKE
FT                   ATRRGFICAMRLEDFRSGTVRPHEKTFQAVKDERLGLMLSCGANLSSVFSLYSDPESVV
FT                   DETLRSGREAAPAMAFVDRQGMSHRIWRVTDRGVLQRVAELMKGKAIFIADGHHRYETG
FT                   LNYRDLQRRRNPSAGPHAAFEYIMMYLSNLNQEGLTILPTHRLLRNLGSWDPESILKRA
FT                   EAFFEVKRFSSDVPGERMLCSELASRGDRKETAIGFFWDNVGSFFLLSARREPVSSYLA
FT                   GRGIPVETRGLDVVVLDQVVLRNLLGLSEEYLSSEHNIHFKHDLAESIGAVRSGDYEAA
FT                   FLINPTRIEQVQEVASAKLVMPHKSTYFYPKVGSGMVIRSLSPEEETVW"
     MAEIAPFRGL RYSPKAAPDL AKVVIPPYDV ISPAEQELFL HTSPYNMVHL ELGRSDRSDT        60
     PENNSHTRAG RTFEDWVRNG VLVREALPAV YYYELDYALS PGKEATRRGF ICAMRLEDFR       120
     SGTVRPHEKT FQAVKDERLG LMLSCGANLS SVFSLYSDPE SVVDETLRSG REAAPAMAFV       180
     DRQGMSHRIW RVTDRGVLQR VAELMKGKAI FIADGHHRYE TGLNYRDLQR RRNPSAGPHA       240
     AFEYIMMYLS NLNQEGLTIL PTHRLLRNLG SWDPESILKR AEAFFEVKRF SSDVPGERML       300
     CSELASRGDR KETAIGFFWD NVGSFFLLSA RREPVSSYLA GRGIPVETRG LDVVVLDQVV       360
     LRNLLGLSEE YLSSEHNIHF KHDLAESIGA VRSGDYEAAF LINPTRIEQV QEVASAKLVM       420
     PHKSTYFYPK VGSGMVIRSL SPEEETVW                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page