(data stored in ACNUC7421 zone)

EMBL: CP000478.PE113

CP000478.PE113       Location/Qualifiers
FT   CDS             complement(138194..139078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0114"
FT                   /product="Pyruvate synthase"
FT                   /EC_number="1.2.7.1"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: sat:SYN_00691 pyruvate synthase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15817"
FT                   /db_xref="GOA:A0LEG5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG5"
FT                   /protein_id="ABK15817.1"
FT                   /translation="MELPEVEYILPGTRTCAGCGLPIAYRHMLKALGPKMIMTHPACCL
FT                   TILHGIYPKTPVAINAVNNTFAGTAASASGLVAGLKATGRTDYTVVAMAGDGGTFDMGI
FT                   QALSGAAERETDFIYVCYDNEAYMNTGVQRSSATPSGAVTTTTPVIPKEQAKKDFIQIM
FT                   EAHDPAYLATMCSSYPADIYNKFLKAKAIKGTRFIHMAVPCPTGWSFPTKDTVKIGRLA
FT                   VESAVVVLYEVENGAFRLTGKSLSMARSGKKQPVNEYLEMQGRFKRISAEQLAEFQRQI
FT                   DVKWERFRKRAGF"
     MELPEVEYIL PGTRTCAGCG LPIAYRHMLK ALGPKMIMTH PACCLTILHG IYPKTPVAIN        60
     AVNNTFAGTA ASASGLVAGL KATGRTDYTV VAMAGDGGTF DMGIQALSGA AERETDFIYV       120
     CYDNEAYMNT GVQRSSATPS GAVTTTTPVI PKEQAKKDFI QIMEAHDPAY LATMCSSYPA       180
     DIYNKFLKAK AIKGTRFIHM AVPCPTGWSF PTKDTVKIGR LAVESAVVVL YEVENGAFRL       240
     TGKSLSMARS GKKQPVNEYL EMQGRFKRIS AEQLAEFQRQ IDVKWERFRK RAGF             294
//

If you have problems or comments...

PBIL Back to PBIL home page