(data stored in ACNUC7421 zone)

EMBL: CP000478.PE114

CP000478.PE114       Location/Qualifiers
FT   CDS             complement(139127..140335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0115"
FT                   /product="ketoisovalerate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.7"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: pab:PAB1472 ketoisovalerate
FT                   oxidoreductase subunit vorA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15818"
FT                   /db_xref="GOA:A0LEG6"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG6"
FT                   /protein_id="ABK15818.1"
FT                   /translation="MGQTLILTGTQAAALAAKLCRVQVIAAYPITPQSKIPEVLSEYVE
FT                   KGELQAEFVRVESEHSAMGVCISASLVGARVFTATAANGLAYMHEQLHWAAGARVPVVM
FT                   PVTNRGLGAPWTILNDMQDTIAQRDTGWMQFYCMNNQEVLDQVILAYKVAEQLMVPTMV
FT                   CFDGFRLSHTMMPVSIPAQSDVDKYLPPYEPLHSIDSGNPVNINPVVMTDPLRGPDGEL
FT                   CPSYMGFRFRLQETMESALPVIAEAGRSFAERFGRSYEDNLHRYRTEDAEFIFLTMGSL
FT                   ASEASDTVDILRERGVKAGVVGIRVFRPFPAASLVEATCRAKSVAVVEKAISYGYEGAL
FT                   ATELKAALFSRNGHRPVIYNYITGLGGKDVKPTDLLEVAQEIINGAAGNIPQEKPRWLG
FT                   YGV"
     MGQTLILTGT QAAALAAKLC RVQVIAAYPI TPQSKIPEVL SEYVEKGELQ AEFVRVESEH        60
     SAMGVCISAS LVGARVFTAT AANGLAYMHE QLHWAAGARV PVVMPVTNRG LGAPWTILND       120
     MQDTIAQRDT GWMQFYCMNN QEVLDQVILA YKVAEQLMVP TMVCFDGFRL SHTMMPVSIP       180
     AQSDVDKYLP PYEPLHSIDS GNPVNINPVV MTDPLRGPDG ELCPSYMGFR FRLQETMESA       240
     LPVIAEAGRS FAERFGRSYE DNLHRYRTED AEFIFLTMGS LASEASDTVD ILRERGVKAG       300
     VVGIRVFRPF PAASLVEATC RAKSVAVVEK AISYGYEGAL ATELKAALFS RNGHRPVIYN       360
     YITGLGGKDV KPTDLLEVAQ EIINGAAGNI PQEKPRWLGY GV                          402
//

If you have problems or comments...

PBIL Back to PBIL home page