(data stored in ACNUC7421 zone)

EMBL: CP000478.PE115

CP000478.PE115       Location/Qualifiers
FT   CDS             complement(140763..141047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0116"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01726 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15819"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG7"
FT                   /protein_id="ABK15819.1"
FT                   /translation="MICETVKTGAECAFMTKSGCGYNGGFCHPVVEQCEGCQRTSEWSN
FT                   GIYCTSYPNPAVKWRSSTCNFATHAKAEQQGLQQKINPLKASKRSNKKK"
     MICETVKTGA ECAFMTKSGC GYNGGFCHPV VEQCEGCQRT SEWSNGIYCT SYPNPAVKWR        60
     SSTCNFATHA KAEQQGLQQK INPLKASKRS NKKK                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page