(data stored in ACNUC7421 zone)

EMBL: CP000478.PE116

CP000478.PE116       Location/Qualifiers
FT   CDS             141441..143156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0117"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="TIGRFAM: type IV-A pilus assembly ATPase PilB; PFAM:
FT                   type II secretion system protein E; General secretory
FT                   system II, protein E domain protein; KEGG: gme:Gmet_1393
FT                   type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15820"
FT                   /db_xref="GOA:A0LEG8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG8"
FT                   /protein_id="ABK15820.1"
FT                   /translation="MAGKVRFVAKKIGELLLQEGLISKEQLDRALNEQHQTGERIGGVL
FT                   LKLGFVSEEMLTEFIAKQYSAPQVNIAKLTVPKDVLGLIPLDIAAKYQAVPFGVMGTTV
FT                   NVAMADPGNLFVIDDMRFLTRKNIQVHVASEPAIKKLLSQFYAPDDNFDDVLGMLKEDV
FT                   DVDVIETAEEMDLSFLEDAAEQAPVVKLVNLIMMDAIRKQASDIHLEPYEKLMRVRFRI
FT                   DGVLYEIMRPPLQLKNALISRIKIMARLDIAERRLPQDGRIKLKAKGREMDFRVSVLPT
FT                   LFGEKVVLRLLDKSGLQLDMTKLGFEELQYKHFREAIYQPFGMVLVTGPTGSGKTTTLY
FT                   SALSELNKLSHNISTAEDPVEYNMVGINQVQIHDAIGLNFANALRSFLRQDPDIIMVGE
FT                   VRDFETAEIAVKAALTGHLVLSTLHTNDAPSTINRLLNMGVESFLVSSAVNLVIAQRLV
FT                   RRVCLECREVEDVTHETLLDLGLREDELGTFECFRGRGCAVCNDTGYRGRVALYEVMPM
FT                   HEQIRELVLMGASAAEIKKESIRLGMITLRRSGINKLKAGITSVEEVIRSSAKD"
     MAGKVRFVAK KIGELLLQEG LISKEQLDRA LNEQHQTGER IGGVLLKLGF VSEEMLTEFI        60
     AKQYSAPQVN IAKLTVPKDV LGLIPLDIAA KYQAVPFGVM GTTVNVAMAD PGNLFVIDDM       120
     RFLTRKNIQV HVASEPAIKK LLSQFYAPDD NFDDVLGMLK EDVDVDVIET AEEMDLSFLE       180
     DAAEQAPVVK LVNLIMMDAI RKQASDIHLE PYEKLMRVRF RIDGVLYEIM RPPLQLKNAL       240
     ISRIKIMARL DIAERRLPQD GRIKLKAKGR EMDFRVSVLP TLFGEKVVLR LLDKSGLQLD       300
     MTKLGFEELQ YKHFREAIYQ PFGMVLVTGP TGSGKTTTLY SALSELNKLS HNISTAEDPV       360
     EYNMVGINQV QIHDAIGLNF ANALRSFLRQ DPDIIMVGEV RDFETAEIAV KAALTGHLVL       420
     STLHTNDAPS TINRLLNMGV ESFLVSSAVN LVIAQRLVRR VCLECREVED VTHETLLDLG       480
     LREDELGTFE CFRGRGCAVC NDTGYRGRVA LYEVMPMHEQ IRELVLMGAS AAEIKKESIR       540
     LGMITLRRSG INKLKAGITS VEEVIRSSAK D                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page