(data stored in ACNUC7421 zone)

EMBL: CP000478.PE128

CP000478.PE128       Location/Qualifiers
FT   CDS             159553..160458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_2689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15832"
FT                   /db_xref="GOA:A0LEI0"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI0"
FT                   /protein_id="ABK15832.1"
FT                   /translation="MLSRFVSKLKFLSVLVCIACFCYIAWQSRSLILSVLRNAHLGYLL
FT                   AAVCVWSLSHLTAPLGVSMIYRSLGRTVPYRFALGTHLGLLPARYLPGGIWHTVGRGIR
FT                   YHRYGIDSSLVTVGIFLETAFDLGMAFILGGGCIWALRGTGGWLGLSAAVLLWMSLAGL
FT                   AVTPMLIPLAVGQARYKVSLPRYLEALGAYAMFSCIGPAAFILYLLSLRVITADVSLLE
FT                   IAGAYLYSWGLGVLAFFAPQGIGVFEVVAGALLAPPSALGSVAVLIAGFRLIRLLSDAA
FT                   GWGVSWCFKPREDGQIGEEG"
     MLSRFVSKLK FLSVLVCIAC FCYIAWQSRS LILSVLRNAH LGYLLAAVCV WSLSHLTAPL        60
     GVSMIYRSLG RTVPYRFALG THLGLLPARY LPGGIWHTVG RGIRYHRYGI DSSLVTVGIF       120
     LETAFDLGMA FILGGGCIWA LRGTGGWLGL SAAVLLWMSL AGLAVTPMLI PLAVGQARYK       180
     VSLPRYLEAL GAYAMFSCIG PAAFILYLLS LRVITADVSL LEIAGAYLYS WGLGVLAFFA       240
     PQGIGVFEVV AGALLAPPSA LGSVAVLIAG FRLIRLLSDA AGWGVSWCFK PREDGQIGEE       300
     G                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page