(data stored in ACNUC7421 zone)

EMBL: CP000478.PE130

CP000478.PE130       Location/Qualifiers
FT   CDS             complement(161949..163694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_1707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15834"
FT                   /db_xref="GOA:A0LEI2"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI2"
FT                   /protein_id="ABK15834.1"
FT                   /translation="MVVKLRHYLRCYNKNTELNILNLFSARQNMWSGSFSSSYSCWKRT
FT                   WVTLPIGLLLLVIRTWPRLLHPEVWQEDGTYNLPGFFQNGLTDLLEPVNGYLIVVPKMI
FT                   TMLSVSISITQYPMISTFLACGVMLVVFYIVATAPIHIHGGILLAAACLLLPSNPEVFG
FT                   LPLYSFWWTSILLFVVVFWNANQNDWILRAVIIIMASLSSPVCIATLPLLWVRVCFLRK
FT                   NPREISLTLLATSCVAIQIWIMIHSNIYVVSQINIASFYLIITKFIGSYAIGNIFPMFR
FT                   WYFGLFILSLLIVTVLRDLRSPAKWGLAYLLCATILMSISRLSINHLHQAIGSPRYFFF
FT                   PFIILSWFLLQIALTETSRLLRMGALFILCLSILNAIPVLDRKHDDLNWATHLASCPHF
FT                   KEYELPVHIDGNIAGTWALKLTKQQCNSLLDKDPFFKPAVTGGFPFRVIRKHPDDRPFE
FT                   QNDVTVAINKVQPGNEWLGADPQKSHKNGIVVLGSFMDSGAGTGSLTLKMRRGDKLLYR
FT                   SGLLRSGQFIEVQAPLFRVTTSPVAREWVQLDFSNDLLPDEFSVIFSDRSTDWHEWSAI
FT                   MLKAD"
     MVVKLRHYLR CYNKNTELNI LNLFSARQNM WSGSFSSSYS CWKRTWVTLP IGLLLLVIRT        60
     WPRLLHPEVW QEDGTYNLPG FFQNGLTDLL EPVNGYLIVV PKMITMLSVS ISITQYPMIS       120
     TFLACGVMLV VFYIVATAPI HIHGGILLAA ACLLLPSNPE VFGLPLYSFW WTSILLFVVV       180
     FWNANQNDWI LRAVIIIMAS LSSPVCIATL PLLWVRVCFL RKNPREISLT LLATSCVAIQ       240
     IWIMIHSNIY VVSQINIASF YLIITKFIGS YAIGNIFPMF RWYFGLFILS LLIVTVLRDL       300
     RSPAKWGLAY LLCATILMSI SRLSINHLHQ AIGSPRYFFF PFIILSWFLL QIALTETSRL       360
     LRMGALFILC LSILNAIPVL DRKHDDLNWA THLASCPHFK EYELPVHIDG NIAGTWALKL       420
     TKQQCNSLLD KDPFFKPAVT GGFPFRVIRK HPDDRPFEQN DVTVAINKVQ PGNEWLGADP       480
     QKSHKNGIVV LGSFMDSGAG TGSLTLKMRR GDKLLYRSGL LRSGQFIEVQ APLFRVTTSP       540
     VAREWVQLDF SNDLLPDEFS VIFSDRSTDW HEWSAIMLKA D                           581
//

If you have problems or comments...

PBIL Back to PBIL home page