(data stored in ACNUC7421 zone)

EMBL: CP000478.PE135

CP000478.PE135       Location/Qualifiers
FT   CDS             168224..169528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0136"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: mac:MA1882
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15839"
FT                   /db_xref="GOA:A0LEI7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI7"
FT                   /protein_id="ABK15839.1"
FT                   /translation="MRRKTLRFLSRKALGGRHMVKRELWYEVQSRFKLKESKKSIARSL
FT                   ELSVQTVRSVLKQKAAPSYRRGPGKRTLLSPFEDHIHRRLAALGYCSRAIYEELVEQGY
FT                   TGCYDTVRRFVQPLRKEAQTKATMRFETPPGRQAQVDWGQCWTLISGKRIKVHLFVMTL
FT                   GYSRRLFAKATWDERLATFLACHEEAFEHFGGAAHELVYDNAKTVVVSRDVEGRNVKWN
FT                   ATFWDFSTYYGFRAWAHRPYRAQTKGKVESGVRYVKRFVRGKAFESMAHLNTLLGRWLA
FT                   TVADLRIHGTTHQRPIDLFEQERTLLLPTGAKPPYQVRERAVRYVARDCMVSFETNRYS
FT                   VPLRFVGKPVEVQCANDRILIFHEGSLIVSHPCCTGKHQSLVDREHYTGIFYGIELPSV
FT                   RMLAFDHALPLCSREEVEVRDLAFYERLAQEGGAS"
     MRRKTLRFLS RKALGGRHMV KRELWYEVQS RFKLKESKKS IARSLELSVQ TVRSVLKQKA        60
     APSYRRGPGK RTLLSPFEDH IHRRLAALGY CSRAIYEELV EQGYTGCYDT VRRFVQPLRK       120
     EAQTKATMRF ETPPGRQAQV DWGQCWTLIS GKRIKVHLFV MTLGYSRRLF AKATWDERLA       180
     TFLACHEEAF EHFGGAAHEL VYDNAKTVVV SRDVEGRNVK WNATFWDFST YYGFRAWAHR       240
     PYRAQTKGKV ESGVRYVKRF VRGKAFESMA HLNTLLGRWL ATVADLRIHG TTHQRPIDLF       300
     EQERTLLLPT GAKPPYQVRE RAVRYVARDC MVSFETNRYS VPLRFVGKPV EVQCANDRIL       360
     IFHEGSLIVS HPCCTGKHQS LVDREHYTGI FYGIELPSVR MLAFDHALPL CSREEVEVRD       420
     LAFYERLAQE GGAS                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page