(data stored in ACNUC7421 zone)

EMBL: CP000478.PE136

CP000478.PE136       Location/Qualifiers
FT   CDS             169525..170304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0137"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: chy:CHY_1116 ISChy4, transposition
FT                   helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15840"
FT                   /db_xref="GOA:A0LEI8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI8"
FT                   /protein_id="ABK15840.1"
FT                   /translation="MSSTQLVRIQERLKHLKLYRINEQLESRLEEASRGNVSYGDFLDQ
FT                   LLDEEVSAKKEKNISMRTSMARFPFVKTLESFDFAFQPSIDKKRINELAACRFIANGEN
FT                   VILLGPPGVGKTHLAVALGIKAVTEGYRTHFTQAMPLVASLTKAYAENRIEERLKFYCQ
FT                   PKLLIIDEIGYIPIDRHGAHLFFQLISRRYERGALIVTSNRSFGQWNEIFGDTVIATAI
FT                   LDRILHHSTTVNIKGNSYRLKEKVKAGLLQSPELEQT"
     MSSTQLVRIQ ERLKHLKLYR INEQLESRLE EASRGNVSYG DFLDQLLDEE VSAKKEKNIS        60
     MRTSMARFPF VKTLESFDFA FQPSIDKKRI NELAACRFIA NGENVILLGP PGVGKTHLAV       120
     ALGIKAVTEG YRTHFTQAMP LVASLTKAYA ENRIEERLKF YCQPKLLIID EIGYIPIDRH       180
     GAHLFFQLIS RRYERGALIV TSNRSFGQWN EIFGDTVIAT AILDRILHHS TTVNIKGNSY       240
     RLKEKVKAGL LQSPELEQT                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page