(data stored in ACNUC7421 zone)

EMBL: CP000478.PE138

CP000478.PE138       Location/Qualifiers
FT   CDS             171182..172480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0140"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: dar:Daro_1705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15842"
FT                   /db_xref="GOA:A0LEJ0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ0"
FT                   /protein_id="ABK15842.1"
FT                   /translation="MKRISIIGAGPMGLACAYYLLKRGFHVDVYEKDGVVGGMSASFDF
FT                   GGLMLERYYHFICGPDEDYLGLLDEIGMLDQVRWAETRMGFYYHGKLYEWGNPRALFRF
FT                   PHLDVGTKLRYALHAFHTSRITDWRKLDREEASGWLTKWIGGSGYEILWESLFRKKFHR
FT                   FSKPLSAAWIGSRIRRVARSRKGLFSEEMGYIEKGTESFLGRLKGLIEGMGGNVFLSAP
FT                   VSRILHRNGRVSGVSVEGIDRDYDVVVSTVPLPYVLRIADDLPDSYLCAVRAVNNIGVR
FT                   CVVLRLKHPLSDYFWINVNDPGFGIPGLIEYSNLNPLRDGIVYVPHYMPTESEEWRMAP
FT                   EAVIARAFVYCRRINPALDDGWLVDARLFEYEFAQPICTPGFFSKLPPVSGIIEGLYVA
FT                   DTTHSYPEDRSINESVRIAGMLARMIANERRGL"
     MKRISIIGAG PMGLACAYYL LKRGFHVDVY EKDGVVGGMS ASFDFGGLML ERYYHFICGP        60
     DEDYLGLLDE IGMLDQVRWA ETRMGFYYHG KLYEWGNPRA LFRFPHLDVG TKLRYALHAF       120
     HTSRITDWRK LDREEASGWL TKWIGGSGYE ILWESLFRKK FHRFSKPLSA AWIGSRIRRV       180
     ARSRKGLFSE EMGYIEKGTE SFLGRLKGLI EGMGGNVFLS APVSRILHRN GRVSGVSVEG       240
     IDRDYDVVVS TVPLPYVLRI ADDLPDSYLC AVRAVNNIGV RCVVLRLKHP LSDYFWINVN       300
     DPGFGIPGLI EYSNLNPLRD GIVYVPHYMP TESEEWRMAP EAVIARAFVY CRRINPALDD       360
     GWLVDARLFE YEFAQPICTP GFFSKLPPVS GIIEGLYVAD TTHSYPEDRS INESVRIAGM       420
     LARMIANERR GL                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page