(data stored in ACNUC7421 zone)

EMBL: CP000478.PE139

CP000478.PE139       Location/Qualifiers
FT   CDS             172461..172886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0141"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: rso:RSc0167
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15843"
FT                   /db_xref="GOA:A0LEJ1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ1"
FT                   /protein_id="ABK15843.1"
FT                   /translation="MNGVAFRLKNEFCSRQFAGFLVVGGSAAILNFFCRVFLSGYLSYA
FT                   AAIVVAYLIAMVFAFVLGKCFVFQSRRSSRTAREFINFGLVNGLAVLQTLGISLLLAYV
FT                   VLPYCGVSSHGEEIAHAVGIMVPAFTSYVGHKHFTFK"
     MNGVAFRLKN EFCSRQFAGF LVVGGSAAIL NFFCRVFLSG YLSYAAAIVV AYLIAMVFAF        60
     VLGKCFVFQS RRSSRTAREF INFGLVNGLA VLQTLGISLL LAYVVLPYCG VSSHGEEIAH       120
     AVGIMVPAFT SYVGHKHFTF K                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page