(data stored in ACNUC7421 zone)

EMBL: CP000478.PE14

CP000478.PE14        Location/Qualifiers
FT   CDS             complement(26434..27054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0015"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: ade:Adeh_1957 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15718"
FT                   /db_xref="GOA:A0LE66"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE66"
FT                   /protein_id="ABK15718.1"
FT                   /translation="MTTKHGNSVKAAVAVRKEIIITGFGGQGIVLAGQIVGKAAGLRDR
FT                   KQSTLTQSYGPEARGGACSAQVIISDQAIHYPYVRKPDILICMSQGGFEKYGGLLGENS
FT                   ILIVDQDLVNPPEARCAAFFSIPATRLAEEMGRKMMANIVMLGFFTAVAGAISTEAARQ
FT                   TVTESVPKGTEELNLAAFNKGYDYGAAVLKGRQKKAEGKKGAL"
     MTTKHGNSVK AAVAVRKEII ITGFGGQGIV LAGQIVGKAA GLRDRKQSTL TQSYGPEARG        60
     GACSAQVIIS DQAIHYPYVR KPDILICMSQ GGFEKYGGLL GENSILIVDQ DLVNPPEARC       120
     AAFFSIPATR LAEEMGRKMM ANIVMLGFFT AVAGAISTEA ARQTVTESVP KGTEELNLAA       180
     FNKGYDYGAA VLKGRQKKAE GKKGAL                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page