(data stored in ACNUC7421 zone)

EMBL: CP000478.PE143

CP000478.PE143       Location/Qualifiers
FT   CDS             complement(177260..178372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU2463 glycosyl transferase, group 1
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15847"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ5"
FT                   /protein_id="ABK15847.1"
FT                   /translation="MRVTMVSTSYPFDPEDWRGRFIKEMVYALAEDRAVELSLWAPPGK
FT                   IPDNVAYRPTAAEAAWLKDLLARGGIAHLIRSRTPRGFEAVFKLLWLLRRNCLRKPEAD
FT                   VAHVNWLQNVLPFWGTSIPAVVSVLGTDFGLLRVPGVTGLIRTVLRQRECLIAPNADWM
FT                   VPELEKRFGDVARVRAIPFGVDDRWFSVKPIRTPGAPRQWLVVSRVTEKKIGPLFSWGE
FT                   GLFGTDDELHLLGPMQEDLSIPGWVRYHGPTHPDALESEWFPRAAGLISVSRHDEGRPQ
FT                   VILEAMAARLPILASAIPAHRNVVRHMETGWLASSREEFAGGLEWLARPDHNEAAGASA
FT                   HDWVRREIGTWRDCADRYKTAYRMVTGVEG"
     MRVTMVSTSY PFDPEDWRGR FIKEMVYALA EDRAVELSLW APPGKIPDNV AYRPTAAEAA        60
     WLKDLLARGG IAHLIRSRTP RGFEAVFKLL WLLRRNCLRK PEADVAHVNW LQNVLPFWGT       120
     SIPAVVSVLG TDFGLLRVPG VTGLIRTVLR QRECLIAPNA DWMVPELEKR FGDVARVRAI       180
     PFGVDDRWFS VKPIRTPGAP RQWLVVSRVT EKKIGPLFSW GEGLFGTDDE LHLLGPMQED       240
     LSIPGWVRYH GPTHPDALES EWFPRAAGLI SVSRHDEGRP QVILEAMAAR LPILASAIPA       300
     HRNVVRHMET GWLASSREEF AGGLEWLARP DHNEAAGASA HDWVRREIGT WRDCADRYKT       360
     AYRMVTGVEG                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page