(data stored in ACNUC7421 zone)

EMBL: CP000478.PE148

CP000478.PE148       Location/Qualifiers
FT   CDS             182171..183520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0150"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: gme:Gmet_0066 Fmu, rRNA
FT                   SAM-dependent methyltransferase:Nop2p"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15852"
FT                   /db_xref="GOA:A0LEK0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK0"
FT                   /protein_id="ABK15852.1"
FT                   /translation="MINARVLAFQILLHMDRDASHPDRLIRGMLGRHERLEERDRALLT
FT                   ELVYGVLRWQGRLDWHIDQLSRTRPEKIDPAVRILLRLALYQILMLDRIPDHAAVNEAV
FT                   NMAKTTQPAYLVKFVNGVLREALRRRSRWIWPEAGEEPGKYIAVTTAHPIWYVERLLHE
FT                   FGFEETLDICNANNTVAPMTLRVNALKTSIDTILQWCAEHGIDAEPSGVVPTAVRLSGL
FT                   RRDLAETSIYRDGLVQVQDEASQIVSTLVAPRAGERVLDLCAGFGGKSTHLGILMGDRG
FT                   EVVAVDNSAWKLEELRKNARRQGLRIIKPRTADLFEFSPGTEDLFDRVLLDAPCSGFGT
FT                   LRRNPDIKWRRHLKDPRRFGRIQKEMLDHAARFVKPGGALVYSACTLFQEENDAVAEHF
FT                   AASHPDWQIEPVGPDLPDACRGMASGPFFRTWPHRHQVDGFFAARLKRPA"
     MINARVLAFQ ILLHMDRDAS HPDRLIRGML GRHERLEERD RALLTELVYG VLRWQGRLDW        60
     HIDQLSRTRP EKIDPAVRIL LRLALYQILM LDRIPDHAAV NEAVNMAKTT QPAYLVKFVN       120
     GVLREALRRR SRWIWPEAGE EPGKYIAVTT AHPIWYVERL LHEFGFEETL DICNANNTVA       180
     PMTLRVNALK TSIDTILQWC AEHGIDAEPS GVVPTAVRLS GLRRDLAETS IYRDGLVQVQ       240
     DEASQIVSTL VAPRAGERVL DLCAGFGGKS THLGILMGDR GEVVAVDNSA WKLEELRKNA       300
     RRQGLRIIKP RTADLFEFSP GTEDLFDRVL LDAPCSGFGT LRRNPDIKWR RHLKDPRRFG       360
     RIQKEMLDHA ARFVKPGGAL VYSACTLFQE ENDAVAEHFA ASHPDWQIEP VGPDLPDACR       420
     GMASGPFFRT WPHRHQVDGF FAARLKRPA                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page