(data stored in ACNUC7421 zone)

EMBL: CP000478.PE15

CP000478.PE15        Location/Qualifiers
FT   CDS             complement(27086..27928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0016"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: ade:Adeh_1958 thiamine pyrophosphate
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15719"
FT                   /db_xref="GOA:A0LE67"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE67"
FT                   /protein_id="ABK15719.1"
FT                   /translation="MDRTRKRKDHPLDGLLRTDRIPHIWCPGCGIGTAFSACLVAMQAS
FT                   GIDLKKTAVVSGIGCSGRGAGYTRLDSYHTTHGRAIPFATGMKLANPELNVVVFSGDGD
FT                   LFAIGGNHFIHAARRNIDLTVICVNNLNYGMTGGQAAATTPCMAKTTTTPSGNPEPPFN
FT                   LPLLAFAAGATYIARWTVLHTRDLTKSMEEALTRHGFSFIEVLAPCPTGYGRRNREKPL
FT                   DSLRFYQERTITKNGAHPAEVILDYNRGITLGKFIDTERPTYSDSYDKTCRPASSASM"
     MDRTRKRKDH PLDGLLRTDR IPHIWCPGCG IGTAFSACLV AMQASGIDLK KTAVVSGIGC        60
     SGRGAGYTRL DSYHTTHGRA IPFATGMKLA NPELNVVVFS GDGDLFAIGG NHFIHAARRN       120
     IDLTVICVNN LNYGMTGGQA AATTPCMAKT TTTPSGNPEP PFNLPLLAFA AGATYIARWT       180
     VLHTRDLTKS MEEALTRHGF SFIEVLAPCP TGYGRRNREK PLDSLRFYQE RTITKNGAHP       240
     AEVILDYNRG ITLGKFIDTE RPTYSDSYDK TCRPASSASM                             280
//

If you have problems or comments...

PBIL Back to PBIL home page