(data stored in ACNUC7421 zone)

EMBL: CP000478.PE150

CP000478.PE150       Location/Qualifiers
FT   CDS             complement(184993..186771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15854"
FT                   /db_xref="GOA:A0LEK2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK2"
FT                   /protein_id="ABK15854.1"
FT                   /translation="MSNERKTFLFGLIALTSISLALRLHDLDAESLFMDEARQISYYAL
FT                   SLRDIITYAATQVQPPLDYWIGHAVFLIDRSVFAARLPAALFGVGSVGLLAILLSRYCS
FT                   WQVSLLTGLLMAILPFHLYFSQEARPYSIVMFLLLVVLWQLDNFMRDSSLRARHLLALP
FT                   GACVLFLYSSGLSPLMVIVALFSVLGAPVLVSLVRPGRLAPERRKRSLAAMGTICIAIG
FT                   LYLPIFFILVQTSRRYAPHLSKADPAIYLTHLLNFSFFPLWRAYVTQLEPIGLLLLPFV
FT                   LAAIVLAIKRRGEPGFFLPKIVAATLPCAAVLHLFAYGANTESPFRPPYPMYILPLTLF
FT                   LAACAWHELASRLQAVKIPGRRVLLASITVLMFVFVLHSTWAFKTMRRKADVNGIREYI
FT                   AGVRHPGTVFFTGGLVGFGGWYPEFELGKSPHCPLEALPLVDDRRLLSEGEPVFLFFTF
FT                   HEYFLTPFSKYPIVPIPGDKTPLPLERLRNSPVLSCAEYIGYEGVRLKNPSGRLAEDAF
FT                   RIAEAILEQLPDNNALVDLRVATAKLGRALGRTDYEEHIRKSMAVLDPSERAVLTARLL
FT                   RASPPMIAHPKESNQP"
     MSNERKTFLF GLIALTSISL ALRLHDLDAE SLFMDEARQI SYYALSLRDI ITYAATQVQP        60
     PLDYWIGHAV FLIDRSVFAA RLPAALFGVG SVGLLAILLS RYCSWQVSLL TGLLMAILPF       120
     HLYFSQEARP YSIVMFLLLV VLWQLDNFMR DSSLRARHLL ALPGACVLFL YSSGLSPLMV       180
     IVALFSVLGA PVLVSLVRPG RLAPERRKRS LAAMGTICIA IGLYLPIFFI LVQTSRRYAP       240
     HLSKADPAIY LTHLLNFSFF PLWRAYVTQL EPIGLLLLPF VLAAIVLAIK RRGEPGFFLP       300
     KIVAATLPCA AVLHLFAYGA NTESPFRPPY PMYILPLTLF LAACAWHELA SRLQAVKIPG       360
     RRVLLASITV LMFVFVLHST WAFKTMRRKA DVNGIREYIA GVRHPGTVFF TGGLVGFGGW       420
     YPEFELGKSP HCPLEALPLV DDRRLLSEGE PVFLFFTFHE YFLTPFSKYP IVPIPGDKTP       480
     LPLERLRNSP VLSCAEYIGY EGVRLKNPSG RLAEDAFRIA EAILEQLPDN NALVDLRVAT       540
     AKLGRALGRT DYEEHIRKSM AVLDPSERAV LTARLLRASP PMIAHPKESN QP               592
//

If you have problems or comments...

PBIL Back to PBIL home page