(data stored in ACNUC7421 zone)

EMBL: CP000478.PE154

CP000478.PE154       Location/Qualifiers
FT   CDS             complement(189953..190960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0156"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: sat:SYN_02985 DNA polymerase III, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15858"
FT                   /db_xref="GOA:A0LEK6"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK6"
FT                   /protein_id="ABK15858.1"
FT                   /translation="MSFKDIPGQERTKRLLKRMARAGTLPHAVLFSGMAGVGKLRVARE
FT                   LAKLVNCLEPRDDESCDRCISCRKIDEGHHPDLFVIRSEGTFIKLDRIRELRERVRFRP
FT                   FEGRFRVVIIENAQHLHDESGNALLKVLEEPPRANLFLLTAIEPQMLLPTIVSRCSHLR
FT                   LQPLEDEVIAGELAASLKIPEAQARELTRLSGGSLDRAQWLAREEHLSHWKEIVENLRK
FT                   SERSGTADVLAMAGRWAQQKEDLEQDLECVKLWVRDLLLSRVIDGYRQAFEPDDPCAVC
FT                   GGEVSPDSLLTLYDRVEESIGRLRGNANKQLVMESICLNIKDVLYGKGCWNPLP"
     MSFKDIPGQE RTKRLLKRMA RAGTLPHAVL FSGMAGVGKL RVARELAKLV NCLEPRDDES        60
     CDRCISCRKI DEGHHPDLFV IRSEGTFIKL DRIRELRERV RFRPFEGRFR VVIIENAQHL       120
     HDESGNALLK VLEEPPRANL FLLTAIEPQM LLPTIVSRCS HLRLQPLEDE VIAGELAASL       180
     KIPEAQAREL TRLSGGSLDR AQWLAREEHL SHWKEIVENL RKSERSGTAD VLAMAGRWAQ       240
     QKEDLEQDLE CVKLWVRDLL LSRVIDGYRQ AFEPDDPCAV CGGEVSPDSL LTLYDRVEES       300
     IGRLRGNANK QLVMESICLN IKDVLYGKGC WNPLP                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page