(data stored in ACNUC7421 zone)

EMBL: CP000478.PE155

CP000478.PE155       Location/Qualifiers
FT   CDS             complement(191014..192060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0157"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: sat:SYN_02192 HD-superfamily hydrolase;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM: nucleic
FT                   acid binding, OB-fold, tRNA/helicase-type; metal-dependent
FT                   phosphohydrolase, HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15859"
FT                   /db_xref="GOA:A0LEK7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK7"
FT                   /protein_id="ABK15859.1"
FT                   /translation="MSKTFIADIQPNQDIAAAFVVSEKQLRTTRSGTAFLTLRLVDRTG
FT                   EITGRVWDNAAELAAVIPLKGAVFLRGRSETYRDEMQLNIQEARPLKPEAVDPADFLPV
FT                   CPTDRDVLFEKLSGRISEVEDRPCKQLLKAIFKDRVLLSRFKSAPAAKSMHHAYLGGLL
FT                   EHTLSVVELVLRICRLYPFLDRDLLVAGAILHDIGKTDEYVYDLAIDYSHSGRLLGHMV
FT                   LGVQIVDEKLRLLKDFPEEKAWLIKHMILSHHGEAEFGAAKLPMTREAFVLHHADDLDA
FT                   KMNNLTRILSEPKMGNEVWTAYQPLFERFFYRGLPKEQAETPPLEGEETEDERGVQLNL
FT                   WNPEKPKK"
     MSKTFIADIQ PNQDIAAAFV VSEKQLRTTR SGTAFLTLRL VDRTGEITGR VWDNAAELAA        60
     VIPLKGAVFL RGRSETYRDE MQLNIQEARP LKPEAVDPAD FLPVCPTDRD VLFEKLSGRI       120
     SEVEDRPCKQ LLKAIFKDRV LLSRFKSAPA AKSMHHAYLG GLLEHTLSVV ELVLRICRLY       180
     PFLDRDLLVA GAILHDIGKT DEYVYDLAID YSHSGRLLGH MVLGVQIVDE KLRLLKDFPE       240
     EKAWLIKHMI LSHHGEAEFG AAKLPMTREA FVLHHADDLD AKMNNLTRIL SEPKMGNEVW       300
     TAYQPLFERF FYRGLPKEQA ETPPLEGEET EDERGVQLNL WNPEKPKK                    348
//

If you have problems or comments...

PBIL Back to PBIL home page