(data stored in ACNUC7421 zone)

EMBL: CP000478.PE157

CP000478.PE157       Location/Qualifiers
FT   CDS             192519..192881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15861"
FT                   /db_xref="GOA:A0LEK9"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK9"
FT                   /protein_id="ABK15861.1"
FT                   /translation="MSQKGERALSGFPLRAVMRAAADRWIVLRGLSERSPLVAVLLTKR
FT                   RHGVEECLMPLNIVALIAILSLPLVPTFWAILDIPKRRFASPRKKAVWFAIVSTFPFIG
FT                   AMIYIILIRRHTEPIS"
     MSQKGERALS GFPLRAVMRA AADRWIVLRG LSERSPLVAV LLTKRRHGVE ECLMPLNIVA        60
     LIAILSLPLV PTFWAILDIP KRRFASPRKK AVWFAIVSTF PFIGAMIYII LIRRHTEPIS       120
//

If you have problems or comments...

PBIL Back to PBIL home page