(data stored in ACNUC7421 zone)

EMBL: CP000478.PE16

CP000478.PE16        Location/Qualifiers
FT   CDS             complement(28280..29437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0017"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain protein; KEGG:
FT                   aba:Acid345_1810 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15720"
FT                   /db_xref="GOA:A0LE68"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE68"
FT                   /protein_id="ABK15720.1"
FT                   /translation="MKPAVLTGEHFFTGDIACAEGALAAGCRFFAGYPITPATEIAEHM
FT                   ASRLPDVGGTFIQMEDEIAAMAAVLGASNAGVKSMTATSGPGFSLMMENLGLGICTETP
FT                   CVVVNVQRAGPSTGLPTLGAQGDMMQARWGSHGHYEIIALAPASPQEIFHQTITAFNLS
FT                   ETYRVPVLIMADEVVGHLSERVSVPDAQAIKLRSRPRPKGRKDRFKPFLPGPGGVAPMA
FT                   VAGEGYGVHVTGLTHDERGYPVMTAEAHVEMIDRLTAKIRNNMRDISMTERYRLEDADI
FT                   AVISYGVSSRSSMAAVDEAREAGIKAGLLRLVTVWPFPEELIRELSERVRSFVTVEINL
FT                   GQIHLEVQRCAAGRVPAYLVGHAGGTVIPPEQVLETLRKVSGSGS"
     MKPAVLTGEH FFTGDIACAE GALAAGCRFF AGYPITPATE IAEHMASRLP DVGGTFIQME        60
     DEIAAMAAVL GASNAGVKSM TATSGPGFSL MMENLGLGIC TETPCVVVNV QRAGPSTGLP       120
     TLGAQGDMMQ ARWGSHGHYE IIALAPASPQ EIFHQTITAF NLSETYRVPV LIMADEVVGH       180
     LSERVSVPDA QAIKLRSRPR PKGRKDRFKP FLPGPGGVAP MAVAGEGYGV HVTGLTHDER       240
     GYPVMTAEAH VEMIDRLTAK IRNNMRDISM TERYRLEDAD IAVISYGVSS RSSMAAVDEA       300
     REAGIKAGLL RLVTVWPFPE ELIRELSERV RSFVTVEINL GQIHLEVQRC AAGRVPAYLV       360
     GHAGGTVIPP EQVLETLRKV SGSGS                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page