(data stored in ACNUC7421 zone)

EMBL: CP000478.PE168

CP000478.PE168       Location/Qualifiers
FT   CDS             complement(204808..205995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15872"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM0"
FT                   /protein_id="ABK15872.1"
FT                   /translation="MNIKQGPRESTSGWLALIGLASLLIWPCPSAHAQANKPLAAGPPP
FT                   VPVRILLAIPDEFASFSYASLIRGRETRHLFGAEAQAAFKNMIAPEFMVFKTRRVSSPA
FT                   AAMAMLSPGDPNNAQTREFDYLAIPRFARVNVSARGRKYGFDVDILVDFHATDGRTITT
FT                   IEGHGESTTGVHFSISPQEAGNLALRCSMEALRDAIIGRRELFVPIRARVEPPREESSR
FT                   SGPQAGRGSAPLPVKVLLAVPDEFSRYAHQIDPGEGGIENDIGGEAERQFRIILSPGFE
FT                   TLVIRPTESESAAMELLSSHSPANIDARGFDYVAIPRFTRIDSRVRGSHYMFSAEIQLR
FT                   FYPVSGLREVTIKGLGKYEGDLDGGAAEEATGRAIKTAVKAIRESIDQRHDLFLP"
     MNIKQGPRES TSGWLALIGL ASLLIWPCPS AHAQANKPLA AGPPPVPVRI LLAIPDEFAS        60
     FSYASLIRGR ETRHLFGAEA QAAFKNMIAP EFMVFKTRRV SSPAAAMAML SPGDPNNAQT       120
     REFDYLAIPR FARVNVSARG RKYGFDVDIL VDFHATDGRT ITTIEGHGES TTGVHFSISP       180
     QEAGNLALRC SMEALRDAII GRRELFVPIR ARVEPPREES SRSGPQAGRG SAPLPVKVLL       240
     AVPDEFSRYA HQIDPGEGGI ENDIGGEAER QFRIILSPGF ETLVIRPTES ESAAMELLSS       300
     HSPANIDARG FDYVAIPRFT RIDSRVRGSH YMFSAEIQLR FYPVSGLREV TIKGLGKYEG       360
     DLDGGAAEEA TGRAIKTAVK AIRESIDQRH DLFLP                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page