(data stored in ACNUC7421 zone)

EMBL: CP000478.PE169

CP000478.PE169       Location/Qualifiers
FT   CDS             complement(206485..206883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0171"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15873"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM1"
FT                   /protein_id="ABK15873.1"
FT                   /translation="MKDLKAGSVMTKPVVFARKDTTARDITVQLLNGLYSGMPITDEED
FT                   QVIGIVTELDLLEAASEGRDLGELTAEEVMTKDPFTTDIDTPISEVINLMREYNIIRLP
FT                   VTEQGALVGIVSRCDILRKIIDPAQYVL"
     MKDLKAGSVM TKPVVFARKD TTARDITVQL LNGLYSGMPI TDEEDQVIGI VTELDLLEAA        60
     SEGRDLGELT AEEVMTKDPF TTDIDTPISE VINLMREYNI IRLPVTEQGA LVGIVSRCDI       120
     LRKIIDPAQY VL                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page