(data stored in ACNUC7421 zone)

EMBL: CP000478.PE172

CP000478.PE172       Location/Qualifiers
FT   CDS             complement(209671..211299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0174"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: plt:Plut_1995 succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; TIGRFAM:
FT                   succinate dehydrogenase or fumarate reductase, flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15876"
FT                   /db_xref="GOA:A0LEM4"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM4"
FT                   /protein_id="ABK15876.1"
FT                   /translation="MNVSGKADAAVLSKVYPTRSHSGAAQGGFNAVMGEDDSIEAHVFD
FT                   TVKGSDYLGDQEAIEVLCSDGPRVILDLERMGVPWTRAEDGRIAQRSLGGAGFPRACFA
FT                   ADFSGHVVLHTLYEQALKRGVKTYPEWHLLEILVDKGRVFGAVIYDLARARLEVIRAKR
FT                   IVLATGGYGRAFLKTTNGHANTGDGMAIAYRAGAVLSDMEFVQFHPTTLYGTNILISEA
FT                   ARGEGGYLRNALGERFMAEYAPGKMELAPRDVVARAIFKEIKEGRGFEGHYVHLDLTHL
FT                   GERLVAERLPQVRDLAIRYSGVDPARVPMPIEPAQHYSMGGVRTDVWGMTGLEGLMAAG
FT                   EVANVSVHGANRLGGNSLLETVVFGARAGRKAAELAPGEPWPDVSSNTVKDALDRWNRL
FT                   CLAPSAHSRSDDDQFAVRREMATIMTNQVGVFRTGVELEDAVARLEGLRKRYRDLPVPV
FT                   GPQPFNYGLMDYIEVGHLLDLSEIIARGALARRESRGAHYRLDFPQRDDRNWLHHTFAH
FT                   TTDRGPEFSAGPVSITRFQPQERGY"
     MNVSGKADAA VLSKVYPTRS HSGAAQGGFN AVMGEDDSIE AHVFDTVKGS DYLGDQEAIE        60
     VLCSDGPRVI LDLERMGVPW TRAEDGRIAQ RSLGGAGFPR ACFAADFSGH VVLHTLYEQA       120
     LKRGVKTYPE WHLLEILVDK GRVFGAVIYD LARARLEVIR AKRIVLATGG YGRAFLKTTN       180
     GHANTGDGMA IAYRAGAVLS DMEFVQFHPT TLYGTNILIS EAARGEGGYL RNALGERFMA       240
     EYAPGKMELA PRDVVARAIF KEIKEGRGFE GHYVHLDLTH LGERLVAERL PQVRDLAIRY       300
     SGVDPARVPM PIEPAQHYSM GGVRTDVWGM TGLEGLMAAG EVANVSVHGA NRLGGNSLLE       360
     TVVFGARAGR KAAELAPGEP WPDVSSNTVK DALDRWNRLC LAPSAHSRSD DDQFAVRREM       420
     ATIMTNQVGV FRTGVELEDA VARLEGLRKR YRDLPVPVGP QPFNYGLMDY IEVGHLLDLS       480
     EIIARGALAR RESRGAHYRL DFPQRDDRNW LHHTFAHTTD RGPEFSAGPV SITRFQPQER       540
     GY                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page