(data stored in ACNUC7421 zone)

EMBL: CP000478.PE175

CP000478.PE175       Location/Qualifiers
FT   CDS             212797..213237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15879"
FT                   /db_xref="GOA:A0LEM7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM7"
FT                   /protein_id="ABK15879.1"
FT                   /translation="MTQIFSIVTYVLAVLLLTGCSSMGDSSPSQGVIEKVDMSRVEVLP
FT                   TEDVMQGAKVRSFRSMDKDGDGAITWEEWQQEDTSQEAEARFDTLDGDKDAKIGYDEFI
FT                   KSENSYVDSEDVYISLDRQKDGMLSRGEEKRLEGVKLFKIEF"
     MTQIFSIVTY VLAVLLLTGC SSMGDSSPSQ GVIEKVDMSR VEVLPTEDVM QGAKVRSFRS        60
     MDKDGDGAIT WEEWQQEDTS QEAEARFDTL DGDKDAKIGY DEFIKSENSY VDSEDVYISL       120
     DRQKDGMLSR GEEKRLEGVK LFKIEF                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page