(data stored in ACNUC7421 zone)

EMBL: CP000478.PE178

CP000478.PE178       Location/Qualifiers
FT   CDS             complement(216833..217315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0180"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: gme:Gmet_2678 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15882"
FT                   /db_xref="GOA:A0LEN0"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN0"
FT                   /protein_id="ABK15882.1"
FT                   /translation="MSKESFSNIAFCTDFSENADLSFETARDLASHYGATLHIVHVMVN
FT                   FSLAPPIHATYMPIEYDPKFVEQVTEAARGSIQERYVSKLAGSQRFDVHLLSGYASTEI
FT                   IRVAEERDIDLIVMGSHGLTGLAHVLFGSTADRVVRRAPCSVLTVRMKKKKMPEKP"
     MSKESFSNIA FCTDFSENAD LSFETARDLA SHYGATLHIV HVMVNFSLAP PIHATYMPIE        60
     YDPKFVEQVT EAARGSIQER YVSKLAGSQR FDVHLLSGYA STEIIRVAEE RDIDLIVMGS       120
     HGLTGLAHVL FGSTADRVVR RAPCSVLTVR MKKKKMPEKP                             160
//

If you have problems or comments...

PBIL Back to PBIL home page