(data stored in ACNUC7421 zone)

EMBL: CP000478.PE181

CP000478.PE181       Location/Qualifiers
FT   CDS             218430..218672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15885"
FT                   /db_xref="GOA:A0LEN3"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN3"
FT                   /protein_id="ABK15885.1"
FT                   /translation="MSANGCAFPPFRFRDEWPMKERFSQVRLRVLVLRILMGLVFGFMV
FT                   TRFFFPRSTMGFMLLISALLVFFAYGMEWVHKGRD"
     MSANGCAFPP FRFRDEWPMK ERFSQVRLRV LVLRILMGLV FGFMVTRFFF PRSTMGFMLL        60
     ISALLVFFAY GMEWVHKGRD                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page