(data stored in ACNUC7421 zone)

EMBL: CP000478.PE183

CP000478.PE183       Location/Qualifiers
FT   CDS             219834..220838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0185"
FT                   /product="HflC protein"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   pca:Pcar_2263 probable lambda CII stability-governing
FT                   protein (HflC)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15887"
FT                   /db_xref="GOA:A0LEN5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN5"
FT                   /protein_id="ABK15887.1"
FT                   /translation="MRQTESRGTDVISRKMSVVAVLAVVVGIVLYFSAYIVTETEQVVV
FT                   TQMGAPVGEPVTKAGLYFMTPFIQTANYFEKRIMKWDGSPNQIPTRDKKYIWVDITARW
FT                   RIKDPLLFLKRVGSVQLAHSRLDGILDSVVRDYVSNNDLIELVRSEGWEEAWQRLKEAG
FT                   IPDFQSTDPGAASEHLVKGREKITREMVADAAKLLPEFGIELHDIRIKRINYVESVQKK
FT                   VFDRMISERKRIAAQYRSEGEGERAAILGQMERELAKINSEAYRKSQELRGKADAETTR
FT                   IYAEAFNRNPEFYSFYRSLELYRDFNSSGSSFVLGTDADVFKYLKNGGKAAGR"
     MRQTESRGTD VISRKMSVVA VLAVVVGIVL YFSAYIVTET EQVVVTQMGA PVGEPVTKAG        60
     LYFMTPFIQT ANYFEKRIMK WDGSPNQIPT RDKKYIWVDI TARWRIKDPL LFLKRVGSVQ       120
     LAHSRLDGIL DSVVRDYVSN NDLIELVRSE GWEEAWQRLK EAGIPDFQST DPGAASEHLV       180
     KGREKITREM VADAAKLLPE FGIELHDIRI KRINYVESVQ KKVFDRMISE RKRIAAQYRS       240
     EGEGERAAIL GQMERELAKI NSEAYRKSQE LRGKADAETT RIYAEAFNRN PEFYSFYRSL       300
     ELYRDFNSSG SSFVLGTDAD VFKYLKNGGK AAGR                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page