(data stored in ACNUC7421 zone)

EMBL: CP000478.PE189

CP000478.PE189       Location/Qualifiers
FT   CDS             226341..227336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb0964 periplasmic protein TonB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15893"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP1"
FT                   /protein_id="ABK15893.1"
FT                   /translation="MKKGRRPIELEDHDRTLGRGLELGADRYDEDEIIDLDEIIEVDAG
FT                   VLEDDEDFDLDVELIDLDADLDLDDLEPEVASSTGKQREEPFRLEVTQWPAPSLSVDEL
FT                   KAPAAQITVPRIEIPPAFEVKVQEPPSELKGPARAPEPEVDPLADLLEGLRKGPAREPE
FT                   PEVKVEEPPPEVRMKEPDYFDTLLAAEMSRSLEKEPQPTVEEAVGKLPELVDVAVTAAA
FT                   VAPAVLAAEAVATVSPAPAPAAPPELVAEPVVPPVGTVEVMAPVVSEPEVPAPKTISPE
FT                   PISEAQLEDLASRIESKLLEAVREIVEARLPGIVEAVLREEIDRLKKELA"
     MKKGRRPIEL EDHDRTLGRG LELGADRYDE DEIIDLDEII EVDAGVLEDD EDFDLDVELI        60
     DLDADLDLDD LEPEVASSTG KQREEPFRLE VTQWPAPSLS VDELKAPAAQ ITVPRIEIPP       120
     AFEVKVQEPP SELKGPARAP EPEVDPLADL LEGLRKGPAR EPEPEVKVEE PPPEVRMKEP       180
     DYFDTLLAAE MSRSLEKEPQ PTVEEAVGKL PELVDVAVTA AAVAPAVLAA EAVATVSPAP       240
     APAAPPELVA EPVVPPVGTV EVMAPVVSEP EVPAPKTISP EPISEAQLED LASRIESKLL       300
     EAVREIVEAR LPGIVEAVLR EEIDRLKKEL A                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page