(data stored in ACNUC7421 zone)

EMBL: CP000478.PE192

CP000478.PE192       Location/Qualifiers
FT   CDS             231036..231743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0194"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: gsu:GSU0768 AzlC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15896"
FT                   /db_xref="GOA:A0LEP4"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP4"
FT                   /protein_id="ABK15896.1"
FT                   /translation="MKDFRKIFVAGIKAAWPICLGYFPIGLAFGVLARKAGIEPLYIGA
FT                   MSLLVFAGSAQFIAVSMLSAGTDPVSIVLTTFVVNLRHILMSSSLSVYFQHCSRKFISL
FT                   TAYGVTDESFAVNQTRFRSGSWTPGEALAVNQVSNAAWVSSTILGGYCGELIPEGSFGI
FT                   DYALSAMFISLLVLQLRGRLYILTALISGSLAVLLAVLLPGNIHVMAASLVAATFGFVL
FT                   RRQASRRVKDTHA"
     MKDFRKIFVA GIKAAWPICL GYFPIGLAFG VLARKAGIEP LYIGAMSLLV FAGSAQFIAV        60
     SMLSAGTDPV SIVLTTFVVN LRHILMSSSL SVYFQHCSRK FISLTAYGVT DESFAVNQTR       120
     FRSGSWTPGE ALAVNQVSNA AWVSSTILGG YCGELIPEGS FGIDYALSAM FISLLVLQLR       180
     GRLYILTALI SGSLAVLLAV LLPGNIHVMA ASLVAATFGF VLRRQASRRV KDTHA            235
//

If you have problems or comments...

PBIL Back to PBIL home page