(data stored in ACNUC7421 zone)

EMBL: CP000478.PE199

CP000478.PE199       Location/Qualifiers
FT   CDS             235953..237074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0202"
FT                   /product="NADH dehydrogenase (ubiquinone)"
FT                   /EC_number="7.1.1.2"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 49kDa;
FT                   KEGG: dps:DP1318 probable NADH dehydrogenase, subunit 7"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15903"
FT                   /db_xref="GOA:A0LEQ1"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ1"
FT                   /protein_id="ABK15903.1"
FT                   /translation="MPKRFLAPVTEQIYTLNLGPQHPSTHGVLRVLLDLDGEFIVKADP
FT                   VIGYGHRGHEKMGENRLFKQFLPNTSRLDYLSGFLFNHGYVLAVEKLAGIPVPPRAQFI
FT                   RTICSEFNRIASHLLWFGTYVMDLGGFTPFLYAFDDRERILDILDWVTGSRLTYSYCRF
FT                   GGVDRDIDTRFTDMARDFIKRLRSRWPDYHNLVTRNIIFIHRTRGVGVITPEQARQFGV
FT                   TGPNLRACGIAFDTRKAEPYEVYDQFDFEIPVGSDGDALDRYRVRFEEMEQSLRIIEQA
FT                   LDRLPGGPFMNDSVPTRLKPPKGEVYFAFESARGQAAYYLVSDGTPSPYRCHIRVPSFG
FT                   NLHVLTEVLRGTLVADAISILGSVDLVIPEIDR"
     MPKRFLAPVT EQIYTLNLGP QHPSTHGVLR VLLDLDGEFI VKADPVIGYG HRGHEKMGEN        60
     RLFKQFLPNT SRLDYLSGFL FNHGYVLAVE KLAGIPVPPR AQFIRTICSE FNRIASHLLW       120
     FGTYVMDLGG FTPFLYAFDD RERILDILDW VTGSRLTYSY CRFGGVDRDI DTRFTDMARD       180
     FIKRLRSRWP DYHNLVTRNI IFIHRTRGVG VITPEQARQF GVTGPNLRAC GIAFDTRKAE       240
     PYEVYDQFDF EIPVGSDGDA LDRYRVRFEE MEQSLRIIEQ ALDRLPGGPF MNDSVPTRLK       300
     PPKGEVYFAF ESARGQAAYY LVSDGTPSPY RCHIRVPSFG NLHVLTEVLR GTLVADAISI       360
     LGSVDLVIPE IDR                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page