(data stored in ACNUC7421 zone)

EMBL: CP000478.PE2

CP000478.PE2         Location/Qualifiers
FT   CDS             complement(2035..2322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0002"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: gme:Gmet_1417 histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15706"
FT                   /db_xref="GOA:A0LE54"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE54"
FT                   /protein_id="ABK15706.1"
FT                   /translation="MTLTKAHIVENLFAKNIFTKTESAQIIETLFEIVKQTLEHGEDVL
FT                   ISGFGKFSVKEKNQRRGRNPQTGDPIMLSPRKVVTFKCSGVLRERINLAK"
     MTLTKAHIVE NLFAKNIFTK TESAQIIETL FEIVKQTLEH GEDVLISGFG KFSVKEKNQR        60
     RGRNPQTGDP IMLSPRKVVT FKCSGVLRER INLAK                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page