(data stored in ACNUC7421 zone)

EMBL: CP000478.PE203

CP000478.PE203       Location/Qualifiers
FT   CDS             239139..239447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0206"
FT                   /product="NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: dps:DP1314 probable NADH dehydrogenase, subunit 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15907"
FT                   /db_xref="GOA:A0LEQ5"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ5"
FT                   /protein_id="ABK15907.1"
FT                   /translation="MNTLTTYLVIAAVLFCLGLLGILQRRNLVGMLISLELMLNGANLN
FT                   FMAFNRFLAPEPAVGQIIALIVMGLAAAEAAIGLSIIFALFRRMHSINVERAQELRG"
     MNTLTTYLVI AAVLFCLGLL GILQRRNLVG MLISLELMLN GANLNFMAFN RFLAPEPAVG        60
     QIIALIVMGL AAAEAAIGLS IIFALFRRMH SINVERAQEL RG                          102
//

If you have problems or comments...

PBIL Back to PBIL home page