(data stored in ACNUC7421 zone)

EMBL: CP000478.PE204

CP000478.PE204       Location/Qualifiers
FT   CDS             239453..241411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0207"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: dsy:DSY2580 NADH dehydrogenase I chain L;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH-Ubiquinone oxidoreductase (complex I),
FT                   chain 5/L domain protein; NADH/Ubiquinone/plastoquinone
FT                   (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15908"
FT                   /db_xref="GOA:A0LEQ6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEQ6"
FT                   /protein_id="ABK15908.1"
FT                   /translation="MTELLKDPVLLAVVMGATLPFLAMAVILIFTRHNPRLSSFISIGA
FT                   VTVSVCAALYLLYKLHGAGRPVQYQTEWLSSDTLVVPFGYLLDPLSLLMLAIVACISFL
FT                   VQVYSIGYMAGDTGYSRYYAFQSLFAWAMMNMVIAPGMLQLFIFWELVGLASYLLIGFY
FT                   YDKESASQAGKKAFVMTRLGDLGFFLGLIVLTLGFGNLGILDLNEAARTHQISQLLMTV
FT                   SALLIFGGVIGKSAQFPLLTWLPDAMEGPTPVSALLHSATMVAAGVYMFSRIFPLFAAS
FT                   PDAMAMALAIGTATMLLSSTMAMVTYDIKQVWAYSTISQLGFMVMALAAGGYFAGVFHL
FT                   TTHAGFKALLFLCSGIFIHEYHSNDMRLIGKGGGRRLVIPMACMTVGALALSGLPPFSG
FT                   FFSKEAILGVLAAHPNKLWLAAGLLGALMTAYYSFRLIFFILFPRGGIETPHGHSQGHE
FT                   HEAHAGGHGGLIFWAMAVPVMILATLTLFLGFFQSSIEHFLTGNAGRLAAAAHGAAQEA
FT                   GKAAHDGHGAGHYVLLVFAVCMALGGLGWAWVEFGRKKAAQVGFLGRFPRMWDLFAERW
FT                   YLDRLYRQFLDRGIYAGITSLFTRNDRRVIDGGIDGLCFFTVTGGRLFSFLQSGMLQYN
FT                   LLVMIGGVGVVVLLFLV"
     MTELLKDPVL LAVVMGATLP FLAMAVILIF TRHNPRLSSF ISIGAVTVSV CAALYLLYKL        60
     HGAGRPVQYQ TEWLSSDTLV VPFGYLLDPL SLLMLAIVAC ISFLVQVYSI GYMAGDTGYS       120
     RYYAFQSLFA WAMMNMVIAP GMLQLFIFWE LVGLASYLLI GFYYDKESAS QAGKKAFVMT       180
     RLGDLGFFLG LIVLTLGFGN LGILDLNEAA RTHQISQLLM TVSALLIFGG VIGKSAQFPL       240
     LTWLPDAMEG PTPVSALLHS ATMVAAGVYM FSRIFPLFAA SPDAMAMALA IGTATMLLSS       300
     TMAMVTYDIK QVWAYSTISQ LGFMVMALAA GGYFAGVFHL TTHAGFKALL FLCSGIFIHE       360
     YHSNDMRLIG KGGGRRLVIP MACMTVGALA LSGLPPFSGF FSKEAILGVL AAHPNKLWLA       420
     AGLLGALMTA YYSFRLIFFI LFPRGGIETP HGHSQGHEHE AHAGGHGGLI FWAMAVPVMI       480
     LATLTLFLGF FQSSIEHFLT GNAGRLAAAA HGAAQEAGKA AHDGHGAGHY VLLVFAVCMA       540
     LGGLGWAWVE FGRKKAAQVG FLGRFPRMWD LFAERWYLDR LYRQFLDRGI YAGITSLFTR       600
     NDRRVIDGGI DGLCFFTVTG GRLFSFLQSG MLQYNLLVMI GGVGVVVLLF LV               652
//

If you have problems or comments...

PBIL Back to PBIL home page