(data stored in ACNUC7421 zone)

EMBL: CP000478.PE206

CP000478.PE206       Location/Qualifiers
FT   CDS             242973..244394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0209"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: dps:DP1309 probable NADH dehydrogenase,
FT                   subunit 2; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15910"
FT                   /db_xref="GOA:A0LEQ8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ8"
FT                   /protein_id="ABK15910.1"
FT                   /translation="MMKWVLFIPELYYLLMAVVFFACSLSRRLQSGVLYRWAVILAGGG
FT                   LLATVLAVNQNGFIFFDCYRVDLYSQLFKILLALGTFWVIFSCSELQGIDSRYHAEFFL
FT                   LTTVCTLGMMMLVSANELLTVYVSIELSSYSLYLLVPMRKQTEIYVETGIKYFMIGVTA
FT                   SAFMLFGISFIFGVAHTTYVPDLVKTLPSLIKEPAAIIGLVLTLCGFFFKQALFPFHSW
FT                   APDVYMGAANQVTTYIATASKMAAAAMVIRFVNLSGGESPLFTQVLVGLAVLSMTFGNL
FT                   VAIIQKDLKRLLAYSSIAHAGYMMIGILTMSEHGVASAIYYSAAYLVMNFACFMVIMKV
FT                   ADDGRNLQIKELAGLHKRSPLLAMTLMLGLFGLAGIPPTVGFTGKFLVFAAALRKGYLI
FT                   LVIIGMINATISLYYYLIVIKAAYLLEPERPYPDVRVDTWTRALSYGLIVLMIYLGVFP
FT                   DQFVALTEAAARSLP"
     MMKWVLFIPE LYYLLMAVVF FACSLSRRLQ SGVLYRWAVI LAGGGLLATV LAVNQNGFIF        60
     FDCYRVDLYS QLFKILLALG TFWVIFSCSE LQGIDSRYHA EFFLLTTVCT LGMMMLVSAN       120
     ELLTVYVSIE LSSYSLYLLV PMRKQTEIYV ETGIKYFMIG VTASAFMLFG ISFIFGVAHT       180
     TYVPDLVKTL PSLIKEPAAI IGLVLTLCGF FFKQALFPFH SWAPDVYMGA ANQVTTYIAT       240
     ASKMAAAAMV IRFVNLSGGE SPLFTQVLVG LAVLSMTFGN LVAIIQKDLK RLLAYSSIAH       300
     AGYMMIGILT MSEHGVASAI YYSAAYLVMN FACFMVIMKV ADDGRNLQIK ELAGLHKRSP       360
     LLAMTLMLGL FGLAGIPPTV GFTGKFLVFA AALRKGYLIL VIIGMINATI SLYYYLIVIK       420
     AAYLLEPERP YPDVRVDTWT RALSYGLIVL MIYLGVFPDQ FVALTEAAAR SLP              473
//

If you have problems or comments...

PBIL Back to PBIL home page