(data stored in ACNUC7421 zone)

EMBL: CP000478.PE207

CP000478.PE207       Location/Qualifiers
FT   CDS             244516..245967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afm:Afu4g13630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15911"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEQ9"
FT                   /protein_id="ABK15911.1"
FT                   /translation="MGFWMDLIRDILREPWIPRDPKTRAREAAPAPRRAAVPEAKPFCD
FT                   PRSVRACVSVCVPRGECSCHCNAVRDALMEEIARRRVGVVVGGAKFGCRGNCRNGPFLG
FT                   FPQRDFFYCKVNPRDIPGIVNETLINGRILFPLVSVNPERSYRPDIIYERDSGMLVGID
FT                   EHVCMVDVARCFADMEGASAAKSPAVAAVMVRIQEKVRRISGGIGTRADLEALRAILDE
FT                   LRLEVKADPTELGSGLLSAVSHFQDEFRQHVEQGGCPLGVCSKLTEEQVLAATAATQAE
FT                   MAKKAKPEVPKAEKKGPAPAEESRPVEAPGGKREKVPAAAPAPEPSVPAAESATPAAAP
FT                   VHGGPVAARVEAAVPVAAERPAEAEVPAVMPVTTAVEEHGAGPAEMPEAVPEAADTVSA
FT                   AADLAHRECVLSEEMPEASAQAEAMGIETPPSCQVPPVEEAAAIPDVPRGEVEKQPLAP
FT                   KKEKKKSGRKKKDASSKGKSSKKKK"
     MGFWMDLIRD ILREPWIPRD PKTRAREAAP APRRAAVPEA KPFCDPRSVR ACVSVCVPRG        60
     ECSCHCNAVR DALMEEIARR RVGVVVGGAK FGCRGNCRNG PFLGFPQRDF FYCKVNPRDI       120
     PGIVNETLIN GRILFPLVSV NPERSYRPDI IYERDSGMLV GIDEHVCMVD VARCFADMEG       180
     ASAAKSPAVA AVMVRIQEKV RRISGGIGTR ADLEALRAIL DELRLEVKAD PTELGSGLLS       240
     AVSHFQDEFR QHVEQGGCPL GVCSKLTEEQ VLAATAATQA EMAKKAKPEV PKAEKKGPAP       300
     AEESRPVEAP GGKREKVPAA APAPEPSVPA AESATPAAAP VHGGPVAARV EAAVPVAAER       360
     PAEAEVPAVM PVTTAVEEHG AGPAEMPEAV PEAADTVSAA ADLAHRECVL SEEMPEASAQ       420
     AEAMGIETPP SCQVPPVEEA AAIPDVPRGE VEKQPLAPKK EKKKSGRKKK DASSKGKSSK       480
     KKK                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page