(data stored in ACNUC7421 zone)

EMBL: CP000478.PE209

CP000478.PE209       Location/Qualifiers
FT   CDS             247920..249080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0212"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: gme:Gmet_0890 smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15913"
FT                   /db_xref="GOA:A0LER1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER1"
FT                   /protein_id="ABK15913.1"
FT                   /translation="MDTPHGASSGESDRIAWLALRLVPDLGNRSVLRLINRFGSPRAVL
FT                   DAEPKELATVEGLRGKAISALQRKEFLRHPETEWETLQRKGVKLLALNDPEYPSNLSAI
FT                   PDPPAVLFVRGELQPRDLVAVAVVGSRAASPMGMIFTEKLSGELALNGVTIVSGFAVGI
FT                   DSAAHRGAIKAGGRTIAVLGCGLDIDYPYGQGGLRDEIAASGALVTEFPLGTPPVAGHF
FT                   PQRNRIISGLSLGVVVVEAAHRSGSLITARLALEQGREVFAVPGMAHHYRSVGPHRLLR
FT                   EGAKLVEGAEDVLEELRPLIRRSAAPPGEPDERETPVSGLEPDELQALRELDGNPRHID
FT                   EIARSTQWPVGKVMAVLSNLELKGVARQLPGKYFVHTWKQTCRKSK"
     MDTPHGASSG ESDRIAWLAL RLVPDLGNRS VLRLINRFGS PRAVLDAEPK ELATVEGLRG        60
     KAISALQRKE FLRHPETEWE TLQRKGVKLL ALNDPEYPSN LSAIPDPPAV LFVRGELQPR       120
     DLVAVAVVGS RAASPMGMIF TEKLSGELAL NGVTIVSGFA VGIDSAAHRG AIKAGGRTIA       180
     VLGCGLDIDY PYGQGGLRDE IAASGALVTE FPLGTPPVAG HFPQRNRIIS GLSLGVVVVE       240
     AAHRSGSLIT ARLALEQGRE VFAVPGMAHH YRSVGPHRLL REGAKLVEGA EDVLEELRPL       300
     IRRSAAPPGE PDERETPVSG LEPDELQALR ELDGNPRHID EIARSTQWPV GKVMAVLSNL       360
     ELKGVARQLP GKYFVHTWKQ TCRKSK                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page